SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00222.1|PACid:22050611 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00222.1|PACid:22050611
Domain Number 1 Region: 10-218
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.74e-24
Family WD40-repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00222.1|PACid:22050611
Sequence length 668
Sequence
MLTKFETKSNRVRGLSFHPKRPWILASLHSGKMWFTVGNDYKIRLWNYMMHRCLFTLLGH
LDYICTVQFNYEYPWIKKTVSPADDILRLRQMNTDLFSGITAVVKYALEGHDQGVNWASF
HPSLPVIVSGADVRQLKLWRFNGHMNKVLCVMFHAKQDIVLSNSDDKSIRVWDVTKRTCV
QAFPREHDWFWILASHPEMNLLAADRFLRFYEFSTQKDSQVIPIRRPGTINLNQSPRTLS
YSSYELYTIPKDSVSRGDSIQDAKRGVGGSAVFVARNRFANLKNEIVKKSILPIVAQAIF
YAGTGNLLCRAEDRVLIFYLQQRLVLVDLQTPFINIALLSKHSIVIASKKLVHRCTLHET
IRVKSGAWDDNGVFVYKILNHIKYCLPNGDSGIIKTLDVPIYITEISGNTLFCLDWDWKN
RAVIIDATEYVFKLSLLKKKYDQVISFIRNSQLSEGFPEVALHFVKDERTRFYLAIESVN
IQITVALENAIDEKDHWYRLGVEALCQGNAGIVEYAYQRTKNFDRLFFLYLVTGNTSKLS
KMLKIAELKNDVMECCHLPLAYMTATVHGLNDVAEQLAAKLGDNVPSLPQGKVPSLLMPP
SPILCGGDWPLLRIMKGIFEGGLENIGRGVQEEDEEAADADWGKELDIVDGEGTQIGDVG
GSGRWGSE
Download sequence
Identical sequences A0A2G5EXW3
Aquca_003_00222.1|PACid:22050611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]