SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00522.3|PACid:22049334 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00522.3|PACid:22049334
Domain Number 1 Region: 2-127
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.42e-28
Family Cyclophilin (peptidylprolyl isomerase) 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00522.3|PACid:22049334
Sequence length 131
Sequence
MDKFFHLCKTGYFKGMLFHRVVKNFMAQAGNSQRVEAAEDWMLDMKPQNELMSTKHEAFM
LGTSKDIHANKGFDLFITTAPIPDLNDKLVVFGQVIKGEDVVQEIEEVDTDKLYRPKSPI
GIVNISLRRQR
Download sequence
Identical sequences A0A2G5EZ85
Aquca_003_00522.3|PACid:22049334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]