SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_004_00763.1|PACid:22030290 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_004_00763.1|PACid:22030290
Domain Number 1 Region: 82-138
Classification Level Classification E-value
Superfamily F-box domain 0.000000000196
Family F-box domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_004_00763.1|PACid:22030290
Sequence length 355
Sequence
MLIFLVSCFSFVLLSKSLSLKSLLPWASETGLLYIWFWKELLCLFVSSLSKSWSTCSSFE
ISSVMSIKKKFLRSKVENVEGTNGSALLDLPELALDCILEKLEPNELCKMAEVCESLRDR
CRSDYLWERHMKNKWGEVIGQAAYREWELHNILIKDSSQTKKKKSFIKSLSCVCSISWST
PKANKGRKSRNCLPADSIMSLYLSLESGKFWFPAQVYNRENGHVGFMLSCYDAQLSYDSF
TDTFQARYPPHGPRPPVVEDNVQWDRIRAPAIDNPPRKLYGSECLDDLHPGDHIEIQWRR
NKEFPYGWWYGVVGHLDTCDKIQNFCCCHKSGENLKASDADILFIFCGDKSSSVP
Download sequence
Identical sequences A0A2G5EWF6
Aquca_004_00763.1|PACid:22030290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]