SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_004_00781.1|PACid:22030327 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_004_00781.1|PACid:22030327
Domain Number 1 Region: 12-189
Classification Level Classification E-value
Superfamily Cyclophilin-like 7.74e-67
Family Cyclophilin (peptidylprolyl isomerase) 0.000000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_004_00781.1|PACid:22030327
Sequence length 189
Sequence
MDSNAGSVTVEWHQRPQNPKNPIVFFDVTIGTIPAGRIKMELFADITPKTAENFRQFCTG
EYRKSGVPIGYKNCQFHRVIKDFMVQAGDFVKGDGSGCVSIYGSKFDDENFIAKHTGPGL
LSMANSGQNTNGCQFFITCSKCDWLDNKHVVFGRVLGDGLLVMRKIENVATGPNNRPKLS
CVIAECGEM
Download sequence
Identical sequences A0A2G5EWH6
Aquca_004_00781.1|PACid:22030327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]