SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00159.1|PACid:22023896 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00159.1|PACid:22023896
Domain Number 1 Region: 15-94
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.83e-18
Family B3 DNA binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00159.1|PACid:22023896
Sequence length 142
Sequence
MKRIKFFRLIGSKDCQLEVPSEFVEEHGNQLSDVGVLKVRTGDTWNIGLRRFAGRIVFNR
GWKEFADHYSLDAGYCLFFTYSGNSRFDVVICDPGDAEIIYPTKPVKFKKPMLDVETVLP
MTKSNGTVLPMTHNDNQGITNI
Download sequence
Identical sequences A0A2G5EQV5
Aquca_005_00159.1|PACid:22023896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]