SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00544.1|PACid:22024146 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00544.1|PACid:22024146
Domain Number 1 Region: 4-98
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-23
Family B3 DNA binding domain 0.00087
Further Details:      
 
Domain Number 2 Region: 347-438
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000353
Family B3 DNA binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00544.1|PACid:22024146
Sequence length 440
Sequence
MSQYSFFKVMLGDFTHQLHIPPAFVLHYNDILPEKLLLETFLGECWDVKLKKEKNEFFLC
EGWTIFVKDNSLEFGDFLVFRSLGGSKFNVRIYGKHCCEKVGIPKRRKIDLCMSCKRKVN
HRNVYMVLVDEDQLCDSKDQYKVDDEEEREDEVSLQILGDDWCKTGASPRKGVFNKGKEL
AKCNPKKNLSSTRSSFRTKSNNLSKLKLKSNDACRIKKKDNKCVSWIGQSSVKRSKVTLN
KMKKRKIERGIIPLADSKSTDEEIELSSSQDAESTDEETELGSNKDAESTDEEDQSHGFE
QRNLDSLHHDYQKAESKTLNDPDTNACYVYLYVCFRLNSYYFDHALQVHDLYIPMDFADT
YLPKESTNVCIMDSSERAWPAQYSYKRYLSNRWQRCRACLSKGWKALVVANKLREGYVCA
FELIEVENMKLKLSILKKGG
Download sequence
Identical sequences A0A2G5ESG4
Aquca_005_00544.1|PACid:22024146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]