SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_005_00636.2|PACid:22024039 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_005_00636.2|PACid:22024039
Domain Number 1 Region: 343-659
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.11e-36
Family WD40-repeat 0.0036
Further Details:      
 
Domain Number 2 Region: 839-1100
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.96e-36
Family WD40-repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_005_00636.2|PACid:22024039
Sequence length 1129
Sequence
MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMKHFEDQVQAGEWDEVERYLGGF
TKVEDNRYSMKIFFEIRKQKYLEALDRQDRAKAVEILVNDLKVFSSFNEDLFKEITQLLT
LDNFRQNEQLSKYGDTKTARNIMLMELKKLVEANPLFREKLTFPPFKNSRLRTLINQSLN
WQHQLCKYQRPNPDIKTLFIDHTCGPNNGAAARGPLTNSPILGPIPKAGTFPPIGAHSSF
QPVGSQSASAMGGWMSNTNPSVPHAAVPAPPVLLQPPNSAPFLKHPRTPPNAPGMDYQSA
DSEHLLKRMCIGPSEEVTFSGVNHPSNVYSQDDLPKIVVRSLNQGSNVMSMDFHPHQQTI
LLVGTNVGDIAIWEVGSRERLAHKTFKVWDVSACSNPLQAALMKDATICVNRCVWGPDGS
VLGVAFSKHIVQTYAYSQMGELRHHLEIDAHIGGVNDIAFCHPNKQLCLVTCGDDQTIKV
WDASSGRRLYIFEGHEAPVYSVCPHYKENIQFIFSTAIDGKIKAWLYDCLGSRVDYDAPG
LWCTTMAYSADGTRLFSCGTSKDGDSHLVEWNESEGAIKRTYSGFRKRSLGVVQFDTVRN
RFLAAGDEFQIKFWDMENTNMTASIDADGGLPASPKLRFNKEGSLLAVTTNDNGIKILGN
SDGQRLIRMLESRTFEGSRGPSELINTKPQIVHALGSVANVSTSQASNMESSDRLPPSVS
ISSFVRCSNRTTDVKPRISDDIDNNRNWKLAEILDSSQLKALQLPESKVAGKVLRLIYTN
SGQAVLALASNAVHKLWKWQRAERNSSGKSTATIVPQLWQPANGILMKNDTDEASADEES
SACIALSKNDSYVMSASGGKVSLFNMTTFKVMTTFMPPPPAATVLAFHPQDNNIIAIGMD
DSSIQIYNVRVDEVKTKLKGHQKRITGLAFSQALNVLVSSGADAQLCVWSIDGWEKRKAR
ILQTPGGRPGALVGETKVQFHNDQTHILVVHESQIAVYDSKLECTFSWSPRDALSAPVSS
AIYSCDGLLVYVGFGDGAVGVFDVDSLRLRCRIAPSAYLPHSSSSTVYPLVIAAHPSEPN
QIALGMNDGFVHVLEPSDAKWGSPVPQDNGNLPTSNPASSNQPSEPSSR
Download sequence
Identical sequences A0A2G5ESX2
Aquca_005_00636.2|PACid:22024039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]