SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_006_00031.3|PACid:22036291 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_006_00031.3|PACid:22036291
Domain Number 1 Region: 157-345,615-648,750-888
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.75e-19
Family WD40-repeat 0.015
Further Details:      
 
Domain Number 2 Region: 24-215
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000011
Family Quinoprotein alcohol dehydrogenase-like 0.031
Further Details:      
 
Domain Number 3 Region: 264-459,534-585
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000311
Family WD40-repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_006_00031.3|PACid:22036291
Sequence length 1350
Sequence
MSTVPRLAQETWDCMLPGPPSRNNGGSIDCSTSGLLAYGAGSSVSIIDTRSMQLVTVLPM
PAPSGNSSSSSSLSSSSSSSSSSLLAPFVTCVRWTPQSLRRDILTHEPSNSHLILAVGDR
QGRIALFDFRLKHVLLWMDFDPPSNSKLGVQDLCWIRVKTDSWILASINGPSLLSLWNTF
NGRCIWKYDSSPEYFSCIRRDPFDFRHFCVLGLKGFLLSVKLVGDGEDDVVIKEHQIPIN
ESNELLKLERESALNPSTPALAAFPHYIVKFCFSSQWKHILYVTFPKELLVFDLQYETSL
SSTALPRSCSKFIDVTPDPDSELLYCAHLDGKLSTWRRKEEEQVYTMCTMEELMPSIGTS
VPSPTFLAFVLCQSESTLRSVRNLYPDMSPTSAISMDYSNPSDSSGESLVVSKINIISVS
DDGKLWCWFLTAEGARDRSSLSSNTTVSETTFADTKSSTKDVSIDGPVLDASKESEPINV
ISSRLLSTTSPNVKLSFKISLIGQLQLLSSTVTVLAVPSPSLTATLARGGNNPAVAVPLV
ALGTQGGTIDVIDVSANAVAASFSVHNTIIRGLRWLGNSRLVSFSYSQANEKAGGYINKL
VVTCVRSGLNRKFRVLQKPERAPIRALRASSSGRYVLILFRDAPVEVWAMTKNPIMLRSL
ALPFTVLEWTLPTVPRPSQNVSSSRQSSFSSKEHTTLTPASVVSSTSASTEDSKATNSEG
STDDTSESFAFALVNGALGVFEVHGRRIRDFRPKWPSSSFVSSDGLVTAMAYRLPHVVMG
DRSGNIRWWDVTTGVSSSFNTHREGIRRIKFSPVVAGDRSRGRIAVLFYDNTFSLFDLDS
QDPLANSLLQPQLPGTLVLELDWLPLRTDKDEPLVLCIAGADSSFRLIEVNIVEKKSTSL
PRAIKERFRPMPLCSPILLPTAHAMALRMILQLGVKPSWFNTCNTTKDNSSYRIPGTDSS
ARDLRSYMIESCLPPVGDSVVPELLLKVLEPYRREGCILDDERAELYSAVVHKGSAIRFA
FAAAVFGEPSEALFWLQLPRALSHLMNKSFNKPPQKGPVSSFPDLGDTSTLLRVTSKGYS
TGREKKDTVSYGRLKLMAFEQEELWESANERIPWHEKLEGEEAIQNRVHELVSVGNLEAA
VTLLLSTPPEGSYFYANALRAVALSSAVSRSLLELTVKVVAANMVRTDKSLSGTHLLCAV
GRYQEACSQLQDAGCWTAAATLAATHLQGSDYARVLQRWGDHVLHTEHNIWRALILYVAA
GALQEALAALRNAQQPDTAAMFLLACHEINAEFSKSGLSDDESSSDEERQSFVLPSSSLR
HEDVTAVSEYYGQYQRKLVHLCMDLQPLFD
Download sequence
Identical sequences A0A2G5EMM5
Aquca_006_00031.1|PACid:22036292 Aquca_006_00031.2|PACid:22036293 Aquca_006_00031.3|PACid:22036291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]