SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_006_00436.1|PACid:22036747 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_006_00436.1|PACid:22036747
Domain Number 1 Region: 44-236
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.51e-32
Family Nitrogenase iron protein-like 0.00014
Further Details:      
 
Domain Number 2 Region: 290-385
Classification Level Classification E-value
Superfamily Hypothetical protein YjiA, C-terminal domain 3.53e-20
Family Hypothetical protein YjiA, C-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_006_00436.1|PACid:22036747
Sequence length 389
Sequence
MENDDDDETPPLAIEINESSSTNSILQNASSSTTRDEEDGDESVGVTIITGYLGSGKSTL
VNYILNAQHGMKIAVILNEFGDEIGVERAMINEGDGDGGAIVEEWVELANGCVCCTVKHS
LVQALEQLIQRKDRLDHILLETTGLANPAPLASVLWLDDQLESAVRLDSIITVVDAKNLT
HQLSQHHESSSFPETTLQIAFADLIILNKIDLVSPEHSGSESLDVLEKLEKKIHDINSLA
RIIRSVRCEVDLSKILGCRSYDAKHLTHLESLLRDNKSLSNRALHDTSVRTLCISEWDKV
DLDKVRLWLEDILWEKKNNMDVYRCKGVLNVQNSDQVHTLQAVREIYEIVPVRRWKHEEA
RMDKIVFIGRNLQEGLLRNTFRACLLPTE
Download sequence
Identical sequences A0A2G5EPP5
Aquca_006_00436.1|PACid:22036747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]