SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_006_00436.2|PACid:22036748 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_006_00436.2|PACid:22036748
Domain Number 1 Region: 44-206
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.93e-27
Family Nitrogenase iron protein-like 0.00053
Further Details:      
 
Domain Number 2 Region: 260-355
Classification Level Classification E-value
Superfamily Hypothetical protein YjiA, C-terminal domain 3.14e-20
Family Hypothetical protein YjiA, C-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_006_00436.2|PACid:22036748
Sequence length 359
Sequence
MENDDDDETPPLAIEINESSSTNSILQNASSSTTRDEEDGDESVGVTIITGYLGSGKSTL
VNYILNAQHGMKIAVILNEFGDEIGVERAMINEGDGDGGAIVEEWVELANGCVCCTVKHS
LVQALEQLIQRKDRLDHILLETTGLANPAPLASVLWLDDQLESAVRLDSIITDLIILNKI
DLVSPEHSGSESLDVLEKLEKKIHDINSLARIIRSVRCEVDLSKILGCRSYDAKHLTHLE
SLLRDNKSLSNRALHDTSVRTLCISEWDKVDLDKVRLWLEDILWEKKNNMDVYRCKGVLN
VQNSDQVHTLQAVREIYEIVPVRRWKHEEARMDKIVFIGRNLQEGLLRNTFRACLLPTE
Download sequence
Identical sequences A0A2G5EQ16
Aquca_006_00436.2|PACid:22036748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]