SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_007_00094.1|PACid:22048161 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_007_00094.1|PACid:22048161
Domain Number 1 Region: 68-180
Classification Level Classification E-value
Superfamily Cgl1923-like 0.0000968
Family Cgl1923-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_007_00094.1|PACid:22048161
Sequence length 334
Sequence
MILHGPILYGANFLKRETHSPLQLPSSAFSNIAISELFSAIRKKKKKCSLLSLSMEFVLD
KDQHIHDECSTLILPALSIGNVGQLAIDLLVSSSRAERIGYLDDSSVLPCVGNDAYAPVP
QGVLALPLEAYESLSNALTLVQQRSPIVKGMMIEFAKNLADFAATNGKKHVVVLSSLDSG
RRQKIDMSSGTQIYYLSSTSPDGTDDHCEKLGWKVLQEYNIDQRRWKLLSSLAEGNSSED
ASLFEDELLDEDYYPSLPFAAFFSCCKAKGLKVTCVLSYCSEGDNIADSLQMADAVCKLL
GLNPKKLSGNEGSGWLIPPSWKTVYGPPSDMSLY
Download sequence
Identical sequences A0A2G5EIG1
Aquca_007_00094.1|PACid:22048161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]