SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_007_00139.4|PACid:22048616 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_007_00139.4|PACid:22048616
Domain Number 1 Region: 9-302
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.29e-58
Family WD40-repeat 0.0000112
Further Details:      
 
Weak hits

Sequence:  Aquca_007_00139.4|PACid:22048616
Domain Number - Region: 566-722
Classification Level Classification E-value
Superfamily ARM repeat 0.0222
Family RPA1889-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_007_00139.4|PACid:22048616
Sequence length 760
Sequence
MSEVMEIDLAEYKLSCELRGHDDDVRGICICGDAGFATSSRDRTVRFWSVNQQDKRKYKL
SKIMLGHTSFVGPLAWISPNDKFPEGGIVSGGMDTLIMLWNLSTGESVNTMKGHQLQVTG
LFVDDNADIVSTSVDCTIRRWRNGQQVELWEAHKAAVQGILKLPSNEIITGSSDSTLKLW
RDKTCVHTFVGHTDTVRGLAQMPGLGILSASHDGSVRLWDLTGEVLMEMVGHTSLVYSVH
AHVSGLIVSASEDCLSKIWKDGVCVQSIEHPGCVWDAKFLENGDIITACSDGVVRIWTAN
KDGIADSSAQESYAAQISQYKLSRKKVGGLKLEELPGMESLQTPGTKDGQTKIVREGDNG
VAYAWNSSDQKWDKIGEVVDGPEDNLKSPTLDGIQYDYVFDVDIGDGEPTRKLPYNRSDN
PYTVAEKWLLKEDLPLSYREQVVEFILQNSGQKNVSIDTSFCDPYTGSNAYIPGVPSRVS
DVQSKPVFKHIPKKGMLFFDSASYDGILKKIAEFNATLQSDPQKDLSLTEIEQSRLEAIV
KILKDTSHYHCSTFGDVDIALLLKLIISWPVSMVFPVIDLFRMVILHPNGASLLFKHFKD
GNDIVMETITKVTTAPALVANQLTIIRVLTNLFKHSYFHPWLQIHRTEILDAFSSCSPTN
KNIQVSYSTLVLNYAVLLIEKRDQEGQSQVLSAALEIAEDENQDVDSKFRALVAVGSLML
DGGMKKIAMDFDVQSIAKVAHSSKDTKIAEIGADIELLTR
Download sequence
Identical sequences A0A2G5EIR9
Aquca_007_00139.4|PACid:22048616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]