SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_007_00139.5|PACid:22048617 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_007_00139.5|PACid:22048617
Domain Number 1 Region: 7-272
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.41e-50
Family WD40-repeat 0.00012
Further Details:      
 
Weak hits

Sequence:  Aquca_007_00139.5|PACid:22048617
Domain Number - Region: 549-693
Classification Level Classification E-value
Superfamily ARM repeat 0.0206
Family RPA1889-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_007_00139.5|PACid:22048617
Sequence length 731
Sequence
MSEVMEIDLAEYKLSCELRGHDDDVRGICICGDAGFATSSRDRTVRFWSVNQQDKRKYKL
SKIMLGHTSFVGPLAWISPNDKFPEGGIVSGGMDTLIMLWNLSTGESVNTMKGHQLQVTG
LFVDDNADIVSTSVDCTIRRWRNGQQVELWEAHKAAVQGILKLPSNEIITGSSDSTLKLW
RDKTCVHTFVGHTDTVRGLAQMPGLGILSASHDGSVRLWDLTDCLSKIWKDGVCVQSIEH
PGCVWDAKFLENGDIITACSDGVVRIWTANKDGIADSSAQESYAAQISQYKLSRKKVGGL
KLEELPGMESLQTPGTKDGQTKIVREGDNGVAYAWNSSDQKWDKIGEVVDGPEDNLKSPT
LDGIQYDYVFDVDIGDGEPTRKLPYNRSDNPYTVAEKWLLKEDLPLSYREQVVEFILQNS
GQKNVSIDTSFCDPYTGSNAYIPGVPSRVSDVQSKPVFKHIPKKGMLFFDSASYDGILKK
IAEFNATLQSDPKQKDLSLTEIEQSRLEAIVKILKDTSHYHCSTFGDVDIALLLKLIISW
PVSMVFPVIDLFRMVILHPNGASLLFKHFKDGNDIVMETITKVTTAPALVANQLTIIRVL
TNLFKHSYFHPWLQIHRTEILDAFSSCSPTNKNIQVSYSTLVLNYAVLLIEKRDQEGQSQ
VLSAALEIAEDENQDVDSKFRALVAVGSLMLDGGMKKIAMDFDVQSIAKVAHSSKDTKIA
EIGADIELLTR
Download sequence
Identical sequences A0A2G5EIN1
Aquca_007_00139.5|PACid:22048617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]