SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_007_00140.1|PACid:22048419 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_007_00140.1|PACid:22048419
Domain Number 1 Region: 327-630
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.95e-69
Family WD40-repeat 0.0000615
Further Details:      
 
Domain Number 2 Region: 38-286
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.63e-56
Family WD40-repeat 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_007_00140.1|PACid:22048419
Sequence length 863
Sequence
MTSTASFKKNYRSVPILQNFYTGGPFTVSSDDSSNASIKSTIEGDSLKVTALVLSPDDKY
LFTASHSKQIMVWDLSTLKCLRSWKGHEGPVMSMTCDSSGGLLATAGSDRKVLVWDIDGG
YCTHYFKGHKGVVTSIMFHPDPDHLLLFSGSDDATVRVWDLVSKKCLAVLEKHFSTVTSL
AVSENGWTLLSAGRDKIVNLWDLRNYEFKLTVPTYEVLEAVRAIPPESPLAACLGSNDKH
SGKKQKLGSPPIYFLTVGERGVVRIWNSEGGTCLFEQKASDATVTSDKDDAERGFTAVVM
LPLDQGLLCVTNDEQFLFYSPIQSPENTFELKLRKRLVGNNEEIIDMKFLGDEEQFLAVA
TNIEQVQVYDLASMSCSYVLAGHTATVLSLDTCVSSSGRTLLVTGSKDNNVRLWDQEGHC
CIGVGTGHLGAVGAVAFSKKKKNFIVSGSSDHTLKVWSLDGLMEDGNLAINLKAKAVVAA
HDKDINSVAVAPNDSYVCSGSEDRTACVWRLPDLVSVVVLRGHKKGIWSVEFSPVDQCVI
TASGDKTIKLWAISDGSCLKTFEGHTASVLRASFVTRGTQFVSCGADGLVKLWAVRTNEC
IATYDQHENKVWALAVGKKTEMLATGGGDTVNLWHDSTAADKEEEFRREEEGVLKGQELE
NAVSDADYARAIRVAFELRRPHKLFNIFSDLCRKVHADVQVDKALHTLQKEQIHLLFEYV
REWNTKPKLCHIAQFVLFRVFNILSPLEILEIKGISELLESLIPYSQRHFSRIDRLIRST
LLLDYTLSAMSVIEPEGEDKASKVISVLQQEEVNEPVVDDVSQLGIKEKKSSKKRKSGKS
RSGAEKKVRESAFTDASAISVQA
Download sequence
Identical sequences A0A2G5EIQ8
Aquca_007_00140.1|PACid:22048419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]