SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_008_00175.7|PACid:22061574 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_008_00175.7|PACid:22061574
Domain Number 1 Region: 116-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.36e-43
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 563-630
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000157
Family PB1 domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_008_00175.7|PACid:22061574
Sequence length 647
Sequence
MAFAHSSSGGVPDSGSLNDTLYKELWHACAGPLVTVPREGERVYYFPQGHMEQLEASTHQ
ALDQKMPSFNLPSKILCKVVHVQLRAEPETDEVYAQITLLPEPDQSEVTSPDPPLPEPER
CMAHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQNPPWQELVATDLHGNEWHFRH
IFRGQPRRHLLTTGWSVFVSSKRLVAGDAFIFLRGESGELRVGVRRLLRQLSNMPSSVIS
SHSMHLGVLATASHAISTGTLFSVFYKPRTSQSEFIVSLNKYLEARNHKLSVGMRFKMRF
EGEEAPERRFSGTIIRVGENASPWWADSEWRSLKVQWDEPSSIPRPDRVSPWELEPLVCT
PSASQPAQRTKRSRPPVLASTTPDQSIHSTLGMWRTPVEPPLNFSYSGLQRGRELYQSPN
PGSPFPTARKPITLGFSGTSPASAVSSNPLYWSNRVESPTESFKPIINRESGETRKETGN
GYRLFGIQLIENSNVEETLPVVPVSVSALVEDESIPSLDAGSDRHSQPSNINESDIPAVS
SDPEKSCLRSPQEMQSRQIRSCTKVHMQGVAVGRAVDLTLFERYEDLLRKLEGMFDIEGE
LCGPTKKWQVVYTDDEDEIMMVGDDPWQLSSRNLFFLTLHLSHLQTC
Download sequence
Identical sequences A0A2G5EHM2
Aquca_008_00175.7|PACid:22061574 Aquca_008_00175.8|PACid:22061575 Aquca_008_00175.9|PACid:22061576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]