SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00195.2|PACid:22034151 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00195.2|PACid:22034151
Domain Number 1 Region: 89-174
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.11e-25
Family Ribosomal protein L14e 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00195.2|PACid:22034151
Sequence length 195
Sequence
MAPNKVVKPKVTRNPDLIRGIGKYSRSAMYHKRGLWAIKAKNGGVFPRHDAKPAEPKPSE
KAPKFYPAEDVKKPLVNKRKPKPTKLKASITPGTVLIILAGRFKGKRVVFLKQLSSGLLL
VTGPFKINGVPLRRVNQAYVIGTSSKVDISGVNVDKFDDKYFAKEAQKKKKKAEGEFFEA
EKDVSLYFSCVLLLM
Download sequence
Identical sequences A0A2G5ECF8
Aquca_009_00195.2|PACid:22034151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]