SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00261.1|PACid:22034035 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00261.1|PACid:22034035
Domain Number 1 Region: 16-142
Classification Level Classification E-value
Superfamily 14-3-3 protein 4.71e-21
Family 14-3-3 protein 0.0001
Further Details:      
 
Domain Number 2 Region: 226-324
Classification Level Classification E-value
Superfamily 14-3-3 protein 0.0000000000209
Family 14-3-3 protein 0.00042
Further Details:      
 
Weak hits

Sequence:  Aquca_009_00261.1|PACid:22034035
Domain Number - Region: 151-214
Classification Level Classification E-value
Superfamily 14-3-3 protein 0.000955
Family 14-3-3 protein 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00261.1|PACid:22034035
Sequence length 373
Sequence
MIGCVCSKMMASQFLREECVYLAKLSKVLFRYGDMREFMEGVAKMGVKELTNDERYLLCF
AYKKIIKVKIKTWKVICSIEQKEKNLAKVERAKIISKYKNKIGFDISMICLAILELLESE
NSYLIEQTLPKESYKFYLENLAEHIDMTMGNRIENELTKICNGILNILESHLVSHNTLLG
VSAESFAYLYTDYFILKEKIDYRKCLASFKVEAEPDMKKIVSKLSLEDNVYLASVAEEAE
QYDDVVEVMRNIVEKVGVEKLTLEQRYILHLAYEKLLLSIGASWRLLIVFSVRENSTVIT
EKYWNMIRSELDKMYDELEKLMQPKAPAMKQHTFEKSPCKYYFEIQSKCAEYLEMLKSSA
LINDAEESGTKYG
Download sequence
Identical sequences A0A2G5EDA8
Aquca_009_00261.1|PACid:22034035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]