SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00399.1|PACid:22034585 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00399.1|PACid:22034585
Domain Number 1 Region: 75-134
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000837
Family F-box domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00399.1|PACid:22034585
Sequence length 390
Sequence
MLFFLISCFSFILLSNSFSLPWANDIRLLSLWFWKELPCSLELWLKKNKQISSLSNISAR
MSFKKRSLSSKVENVEEMDEMSILDLPDLALENILGMLPPSSLCNMAGVCSSLRDMCRSD
HLWERHMKEKWGKVIDKAAYREWQWHLATKKDNTFNQSTHKGFVRTLSSVWPISWMRSKF
ENRSKPTSPLPVDSIKSWYLSFESGKFWFPAQVYNREHGHVGFMLSCYDAELSYDRRADT
FHARYPPHGRRTIVIEEGVGWDRLRAPPVDTPPHDLHISDCLNDLHPGDHIEIQWRRNKE
FPYGWWYGVVGHLESCDGNENYCRCHSSDTVMLDFNQYTPGSRWRQTIINRKDHREEGNE
TDGFYGGIRKIYSMEEIAMWKRLWPKEVLE
Download sequence
Identical sequences A0A2G5EDE8
Aquca_009_00399.1|PACid:22034585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]