SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00585.1|PACid:22033980 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00585.1|PACid:22033980
Domain Number 1 Region: 52-137
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000563
Family F-box domain 0.0057
Further Details:      
 
Weak hits

Sequence:  Aquca_009_00585.1|PACid:22033980
Domain Number - Region: 232-338
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0549
Family Galactose oxidase, central domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00585.1|PACid:22033980
Sequence length 445
Sequence
MKININKKRRRISAKGKLKLQHTSINKKKKRRISAKDEEETTILTRQQHLSNVLPHDIML
DILSRLPVEPLLRFRSVSRSWNYLIRKDHYFINMHLSRSQIQPTVKETLMFFDTKGKSGL
YSLDYNQKSIRLVPPIHRDLRSRYICTKDDYIWGICNGLICTGNISNMSLCISNPSTAEY
RKVPYFKGSTTELKKVPCTEEIFEFSCHGFGYNPNADDYVVLKLTTYQAEEHQFLSGVTV
YSLRNNSWRRIQNIPYEVFYLLPGQFVNGSLHWLAYSKMISIGDEEDKFEVAKYAILAFE
ITTENFLEVPMPESAESVEAQFGCFMYVSQYQGKFCLFQDNNITTSLFDLTTSFDLWVMN
EYRVKESWVKLFNIQNPDNTRGPFTDFLLCLTKEGSILMQSYSSGGLILYDLKDTSGSDI
LDVKIAKKLGTVHSYVPSISRCQFD
Download sequence
Identical sequences A0A2G5EEE2
Aquca_009_00585.1|PACid:22033980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]