SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00141.1|PACid:22046521 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00141.1|PACid:22046521
Domain Number 1 Region: 116-351
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.01e-35
Family WD40-repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00141.1|PACid:22046521
Sequence length 534
Sequence
MGAISIQETVVPSVPMEDNANDLDPKVKKYLRGDGANLEKLKDKKLKGQLAVREQLYGKS
AKAAAQVEKWLMPSEEGYLEADDLEKTWNIRQDKILGEVDILSSRKPFDLVLPDLGPYTL
DFAPSGRYMIVAGHKGHVALIDMMNMDLIKEFQVKETVRDVVFLHNELFFAAAQKKYPYI
YNRDGTELHCLKEHGAVLKLQFLRNHFLLASINKFGQLHYQDVTMGGMVANYRTGLGRCD
VMQVNPFNAVVGLGHSCGKVTMWRPTSAAPLIKMLCHHGPVSAIAFHPGGHLMATAGMER
KIKLWDIRKFEVLHTYSGHAKTLQFSQKGLLAFGSGLRVQIWKDTAGNQDYSRYMSHSIV
KGYQVGKVNFQPYEDVLGLGHSQGISAILVPGSGEPNFDTWVANPFETPKQRREKEIHSL
LDKLPPETIMLDPTQIGTLRPPRAKEQLTKQEREAAMEAAIESAKQGSNKKKTKGRSKPT
RMQKKKQDGIVKAKRPFLDQQLKEERQLLNKKPKLNEEVQLPLSLQRFARKKAT
Download sequence
Identical sequences A0A2G5E8L9
Aquca_010_00141.1|PACid:22046521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]