SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00338.1|PACid:22046925 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00338.1|PACid:22046925
Domain Number 1 Region: 8-106
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.81e-22
Family B3 DNA binding domain 0.00083
Further Details:      
 
Domain Number 2 Region: 380-472
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-18
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 3 Region: 126-217
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-16
Family B3 DNA binding domain 0.0068
Further Details:      
 
Domain Number 4 Region: 222-302
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-16
Family B3 DNA binding domain 0.0012
Further Details:      
 
Domain Number 5 Region: 541-622
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-16
Family B3 DNA binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00338.1|PACid:22046925
Sequence length 623
Sequence
MDSMLHHTSNIPNFFKVMVGDFQKKLSLPKALTLCFKPKVPKMFTLISPTGSSWMVSVKR
VDKDFFLANGWKTFAEDYALELGEFVVFRYKGDNAFSVKVFGKNACEKEVPSTNKNIEEV
ANHVTSKYPMFTTTVPKGDLTWYTTLIIPKLFAKKYLKNNHLGLTRDVTLRVTTGGTWNL
RYSVGVHRRLIGGWKTFVVGNNLKARDILVFELVDRNPIQMNCLPTDYIKNFNGDVPKQF
ILTSSTRRFWEVFVKKIDNNLFLSEQWPIFAKDNALEFGDLLVFIYNGNLEFRVKIFGSN
ACEKDVELALKNNVESDFYLREEKEGNDRGIPDKLHSPDILKCYKRRRTAEAAVTDKVTS
LPNSMSIKTERSEVMEVGLSFNATFQPSRKYKIGIPNEIVKEKGLSVKDKMLLLDPCGRS
WPVTIYCWSKGRTFLTAGWPAFCKANRLNTNDTCHFQFIDGVDNAIRVEIFRTRTPPPIA
KQASAGVKMSTAIPREVIEAPTRKRPGEFVDDRVIHNGKQESLLMTDCSNNDEQTMSTAP
NVAVLPSAFAKKHMKHAPRGVILRDSNGGTWHAQYKIGSHHKLNMGWKTFVFDNHLKECD
VCIFELVDENLTHYELKVTIIRH
Download sequence
Identical sequences A0A2G5E9G3
Aquca_010_00338.1|PACid:22046925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]