SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00493.1|PACid:22047549 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00493.1|PACid:22047549
Domain Number 1 Region: 25-47,83-204
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000102
Family WD40-repeat 0.027
Further Details:      
 
Weak hits

Sequence:  Aquca_010_00493.1|PACid:22047549
Domain Number - Region: 322-373,737-775
Classification Level Classification E-value
Superfamily TPR-like 0.00228
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 
Domain Number - Region: 574-735
Classification Level Classification E-value
Superfamily ARM repeat 0.0115
Family Armadillo repeat 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00493.1|PACid:22047549
Sequence length 1012
Sequence
MVHSAYDSFEFLNNCPAKIETVGSYGSKLLLGCSNGSLLIYSPESIASDRSPQSSDLNLN
HHQQHQTLELRKEPYVLEKSINGFSKKPIVSMEVSNSRELLVSLSESVAFHRLPNLETIA
VITKAKGANLFAWDDRRGFLCFARQKRVCIFRHDGGRGFVEVKDYGVPDVVKSMSWCGEN
ICIGIRKEYMILNITSGALSEVFPSGRIAPPLVVPLSSGELLLGKDNIGVFVDQNGKLQQ
DGKISWSEAPSVVVINKPYAIGHLPRFIEIRSLRDYQLVQTVALRSGYRLLQSNNFAIAA
LDNSVYGLFPVPLGAQIVQLTASGKFEEALALCKMLPPEDSSLRAAKEASIHLRYGHSLF
DIARYEEAMEQFLASQVDVTYVLSLFPSIVQPKSLAIREPEKVADYAGDVSYLSRASSDA
SEDTEFSPPSHMLDSDNNTLLESQKTSYNSLVALVKFLQKKRYTILERATAEGTEEIVLD
AVGESNLSSDSSRSKYAYKERSNIHIGSGSREMATILDTALVQALLLTGQSSATLELLRG
PNYCDVKICEEFLLQKNYSSALLELYKCNGMHREALKLLIQLLEESKSDKLQPESAKVFK
PDMIIEYLKPLCGTDPMLVLEYSMHVLETCPTQTIELFLSGNIPADLVNSYLKQNAPNMQ
STYLELMLAMNENGISGNLQNEMVQIYLSEVLDMYVDLSSQKKWDEKVYPPCRKKLLSTL
ESISQYNPEALLKRLPADALYEERALILGKMNQHELALSLYVHKLHVPELALAYCDRVYE
TGQRQPRTGSHGNIYVILMQIYLNPHRTTKEFEKRINNIVSSKKPVIQKVSSIRAKGNRM
GKKIAEIEGAEERRISPSGTDSGKSDGDGDEPSEDGDSTIMIDEVLDLLSRRWDKINGTQ
ALKLLPRKTKLQNLLPFLEPLLKKSSEAQRNLSVVKSLRQSENLQVKDDLYKYRRMVVKI
NSDSLCSLCNKKIGTSVFAVYPHGKTLVHFVCFRDSQNIKAVVKGSPLRRRG
Download sequence
Identical sequences A0A2G5EAA1
Aquca_010_00493.1|PACid:22047549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]