SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_011_00122.1|PACid:22038526 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_011_00122.1|PACid:22038526
Domain Number 1 Region: 164-269
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.14e-27
Family B3 DNA binding domain 0.00011
Further Details:      
 
Domain Number 2 Region: 44-99
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000000000144
Family GCC-box binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_011_00122.1|PACid:22038526
Sequence length 347
Sequence
MEEEMVSMVSNTVMAEASDSNSNSNSNLCHPNKRQKHDNSASARFKGVVLQQNGHWGAQI
YVKHERIWLGTFNSEKEAAMAYDSAALKLRGDSFRNFPLTNITIQEPKFQDLYKTEVILS
MIKDRSYNSKFMEFLRNQTQKIEDKVELNLGNGGLMDGGFVYHQLFQKELTPSDVGKLNR
LVIPKKHAVKYFPQVSEGKEGEEEDGGDVDDLQLPFVDRQMKTWKFRYCYWKSSQSYVFT
RGWNRFVKEKELKAKDVITFYLCEHREHPPFRMIDVGYNASENINNGSVGGFSGYFRQNV
DLQLGLSGSLVRDRKQMEEEQNVVISLGQPVVEEKSKGFRLFGVQIS
Download sequence
Identical sequences A0A2G5E5N5
Aquca_011_00122.1|PACid:22038526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]