SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_011_00146.1|PACid:22037987 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_011_00146.1|PACid:22037987
Domain Number 1 Region: 189-452
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 8.89e-19
Family Galactose oxidase, central domain 0.029
Further Details:      
 
Domain Number 2 Region: 120-199
Classification Level Classification E-value
Superfamily F-box domain 0.00000000929
Family F-box domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_011_00146.1|PACid:22037987
Sequence length 474
Sequence
MEEEDLAMLRQIIGQAQELCELFGSPINTNTNTNNNHFISNSSNTFYFNPHHQQQQQQSW
CFLDVDDSSVDDGYYSLILKGRKAGSLKMVEPYKSPPAKKSRKERNRVKHLENSNRAEVM
EQQIWKELPEDLFEAVIARLPTATLFRFRSVCQKLNSLLVSHSFSQHCAEIPQRSPWFYT
ITHEHVSSGTMYDPSSKKWYHPSIASLPTKAIILPVASAGGLVCFLDIGHRNFYVCNPLT
KSFRALPTRSVRVWSRVAVGMTLNGNSTTEGYKVLWLGCDGEYEVFDSLKDTWSRLGNMP
SNIKVPLSLNFRSQAVSIDSTLYFMRSEPDGIVSYDMVNGVWKQFAIPAPPHLTDHSLAE
CGGQIILVGLLTKNAATCVCIWELQKMTLLWKEVDRMPNIWCLEFYGKHVRMTCLGNKGL
LMLSLRSKQMNRLVTYDVSSREWRKVPSCILPSGKKRQWIACGTAFHPSPTAIA
Download sequence
Identical sequences A0A2G5E5S5
Aquca_011_00146.1|PACid:22037987 Aquca_011_00146.2|PACid:22037988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]