SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_011_00401.1|PACid:22038131 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_011_00401.1|PACid:22038131
Domain Number 1 Region: 328-391
Classification Level Classification E-value
Superfamily F-box domain 0.00000497
Family F-box domain 0.0083
Further Details:      
 
Weak hits

Sequence:  Aquca_011_00401.1|PACid:22038131
Domain Number - Region: 33-281
Classification Level Classification E-value
Superfamily Kelch motif 0.000102
Family Kelch motif 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_011_00401.1|PACid:22038131
Sequence length 673
Sequence
MKRSACIEGRSLGSIPLRCPSIVFSHGDKYNGQVFCPLHDGLCHVKRVPEMRRMHCVGSC
YGWLILQNNYSTQCYLFNPTSSEKIDLPPLIHKSFDFGVLTYSPTDPSCVIVLVSKKKYS
IIFCRIGDDTWSEQNLKQEGEKVGGSDIGVTSFEGKVYVFFRQWTNVIYFYQTFAYVQLH
DTKKPQFSVPETCPLVKNLVECCGEIFLVYGTQSLDVFRLDLCSKVWVKVESISNQIFLV
SETSSAALSATELGVKGNCIYFFHREYPCLYRFDMDDGTTTVMRPWQNKFKYWDAPLWMV
PNCNFQMKRELVKIEETKDRVNKENTAIQELPTELFDSIMSHLFLDDWVRFRLTSKAWIS
INRPNSSVKQYKSEFQPMPWLMSFLNKKGVCNFYNPLYSDTYTMTIPELAGAIVRDAKFG
WLLMSQNSSIFFYNPLTMEIIKVRDHRSYCFLNISFSSPPTSSDCIVFGYKISSSPKWAK
VSVYLKKRDWWFDHSFDCADEFMASHCNPVFSDGVFYSLSKDGKLGVFYPSNGNNSGWEV
LPRPAVVCFGKLISNTSTRSFIIEYDGEIFSVALGFMGTPVSVFKLDYSQMEWVRVESLG
DKVAFLSHTSSMLVPAELKGVEDRIYLPKFLRNESIFYSLKTKKYHCFGNKESHADWINT
TEHWNCTWIDSIF
Download sequence
Identical sequences A0A2G5E6Z5
Aquca_011_00401.1|PACid:22038131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]