SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_011_00536.1|PACid:22037730 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_011_00536.1|PACid:22037730
Domain Number 1 Region: 134-328
Classification Level Classification E-value
Superfamily HCP-like 7.19e-39
Family HCP-like 0.0049
Further Details:      
 
Domain Number 2 Region: 66-108
Classification Level Classification E-value
Superfamily F-box domain 0.0000000798
Family F-box domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_011_00536.1|PACid:22037730
Sequence length 355
Sequence
MKQGTWPAASDGSQFSSFNLGRTTTTTTTTTTTTTTITTTETKTQNPCSNFLHKPRRTRL
NPTSSSSSISISNFSLLPFDILTKIAASFNHPDLKSASLVCKSWCFALKPLREAIFFLMW
GKNFKHGRGGVNPNLDKALDSFLKGVYRGSTLAMVDAGLVYWELGKIDQGISLYMKAAEL
GDPAGQCNLGISYLRVEPPNLKEAVKWLYKASTAGHARAQYQLALCLHQGRGVQRNLSEA
AEWYLRAAEGGYVRAMYNASLCYSYGEGLTLSHSHARKWMKRAADRGHGKAQYEHGLSLF
SKGDMVNAVLYLELATRTGETAATTVRNFVYQQLSATSRDRAMRLADNWQPLPSR
Download sequence
Identical sequences A0A2G5E7J4
Aquca_011_00536.1|PACid:22037730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]