SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_012_00096.2|PACid:22037563 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_012_00096.2|PACid:22037563
Domain Number 1 Region: 99-162
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000138
Family Ankyrin repeat 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_012_00096.2|PACid:22037563
Sequence length 177
Sequence
MASTLCTVHLSCSSLKSTCGSFSSSSKMKISSSKFMGMKRRLGWCNGCRIGPSNGSKTIC
WFKFGKNGVDAEGAGIYGSQKREDFDKDDVEQYFNYMGMLAVEGSYDKMEALLSLKIHPV
DILLMMAATEGDKPKIEELLRAGASYTVKDADGRTAIDRAPDEEIKEFILGFSVQKA
Download sequence
Identical sequences A0A2G5E4E7
Aquca_012_00096.2|PACid:22037563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]