SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00063.5|PACid:22059496 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_013_00063.5|PACid:22059496
Domain Number 1 Region: 12-272
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.56e-30
Family WD40-repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00063.5|PACid:22059496
Sequence length 302
Sequence
MSQMSRLGTGADLPYRMAVHPRGEGVICSFPKSCRWFEWDAPENVETHKLDLKSSEKILT
QLEDVGQQLTMTFNFDGSALAVGGEDGHLRVFKWPSMEAILDQIDEKATVKYLSFSSDGK
FLVCLASRGPCRVWDVSSSKIVASLPKESDEVFGFCQFSQTKDNREILYITAMQGKGGGI
VVWDTTSWKRIGSKQIVRDPISAFSVSADGELLAVGTIQGDIYITNSKMRVQTVIKKAHL
GLVTVLMFSEDSRSLVSTSLDSSARVTLIESKEEQNGMSIWVVLFIVLLAILAYFLKSRG
AI
Download sequence
Identical sequences A0A2G5DZG0
Aquca_013_00063.5|PACid:22059496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]