SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00067.4|PACid:22058793 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_013_00067.4|PACid:22058793
Domain Number 1 Region: 111-249
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.22e-38
Family B3 DNA binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 573-650
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000412
Family PB1 domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00067.4|PACid:22058793
Sequence length 696
Sequence
MLICLIWLGFGVDELYTELWKACAGPLVDVPRTGERVFYFPQGHMEQLEASTNQELSQRI
PLFNLPSKILCRVVHIQLLAEQESDEVYAQITLQPEPDQNEPNSPDPIPQELPRPVVHSF
CKILTASDTSTHGGFSVLRKHANESLPPLDMTQSTPTQDLIAKDLHGYEWRFKHIFRGQP
RRHLLTTGWSTFVTSKRLVAGDAFVFLRGENGDLRVGVRRLARQPSCMPSSVISSQSMHL
GVLATASHAVSTQTLFIVYYKPRTSQFIISLNKYLEAVDHGFTVGMRFKMRFEGEDSPER
RFTGTIVGTGDISPQWKDSKWRSLKVQWDELASIQRPERVCPWEIEPFVASAPPSNVIQS
TIIKNKRPRQSVDNPVCDTSSAASAFWYPKSNLSHDLVALSGPEVQSSESQVVWPPRQKE
GNLFNNSSTCSSKNLLDGGWPSPLTKASLNLFQDVNVDDKTVPLWGVLGISGNDQAPKPI
DFPVINDPVETGKKPEPTGGCRLFGIELTNNSRAPPPVNVPTNQTVISSAGTEEVVQAPV
FGANSNQQSGVSKVSGEQGREFLQVSPKESQTKGPTCTRTRTKVHMQGIAVGRAVDLTGL
QGYDQLIKELEDMFEIKGQLCPRDKWEVVFTDDEGDMMLVGDDPWLYVHSITLAMLTIYF
YHLITYKWSLPILTILLHLLNCAGNSVRWLKRFIST
Download sequence
Identical sequences A0A2G5DZG7
Aquca_013_00067.4|PACid:22058793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]