SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00115.5|PACid:22059474 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_013_00115.5|PACid:22059474
Domain Number 1 Region: 253-449
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-35
Family cAMP-binding domain 0.0000087
Further Details:      
 
Domain Number 2 Region: 70-125,187-289
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.36e-21
Family Voltage-gated potassium channels 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00115.5|PACid:22059474
Sequence length 554
Sequence
MSVRDEKFVRFQDWSSDKSLLSERQFSAEDELESGRFRSTVVILIVIPKLRGSVPLLTKN
LVRFIVLFQYVPRFLRIYPLYKEVTRTSGIITETAWAGAAFNLFLYMLASHIFGALWYLF
SIERKDTCWRNACKDDCNMSVLYCGDHSVEGGNPFLNGSCPNWEPDKAPFNFGVYLDAHQ
SGVVESRDFPQKLFYCFWWGLRSLSSLGQNLETSTFVWEIAFAVSISISGLVLFALLIGN
MQTYLQSNTVRLEEMRVKRRDAEQWMSHRLLPENLRERIRRYEQYKWQETRGVDEENLLC
NLPKDLRRDIKRHLCLDLLMRVPMFEKMMDEQLLDALCDRLKPALYTEESYIVREGDPVD
EMLFIMRGKLETVTTNGGRTGFLNSEILKAGDFCGEELLTWALDPHSSSNLPISTRTVHA
LTEVEGFALMADDLKFVASQFRRLHSKQMRHTFRFYSQQWRTWAACFIQAAWRRHCKKKL
EESLREEEDRLQDALAKGGGSSPSLGATIYASRFAANALRAIRRSGTRKARLQERLPPMM
LQKPAEPDFAAEDH
Download sequence
Identical sequences A0A2G5DZU5
Aquca_013_00115.5|PACid:22059474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]