SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00263.1|PACid:22059509 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_013_00263.1|PACid:22059509
Domain Number 1 Region: 47-144
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000255
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00263.1|PACid:22059509
Sequence length 176
Sequence
MEFSARRDGPSEGEKSRGKAKQKIKAKTNKSCINNSQQQLDEHWPLSDKPYFHYILADYQ
VQNQFLLVLPAKIHKVLPKAIVPVILTCRNKNWKMQYYGVGYAHQKFDSGWKNFSIDNKL
NVGDGCVFELTECSTECIKFRVQILSGELPAELLNRGDGSNSTPDGATPDTPIIIF
Download sequence
Identical sequences A0A2G5E0M9
Aquca_013_00263.1|PACid:22059509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]