SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00456.1|PACid:22059406 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_013_00456.1|PACid:22059406
Domain Number 1 Region: 163-358
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.73e-17
Family Cystathionine synthase-like 0.0066
Further Details:      
 
Weak hits

Sequence:  Aquca_013_00456.1|PACid:22059406
Domain Number - Region: 483-575,613-641
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.000241
Family Cystathionine synthase-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00456.1|PACid:22059406
Sequence length 662
Sequence
MHSACVRDVSEVCFYGCCKTPLLGLSETPDPKSKFLTTVAASRADFAAATASSLSPEAQL
TDHESLPSLPESLSRFNKAYPQYRMTDHADSIRAQDYGHLSLSNHVCLDYIGHGLFSYSQ
ISQFPSTPAIASSSSSPPPMHRTSELPFFDVCYKSASLKSQVLYGGQDSELESAIRKRIM
AYLNICEDDYSMVFTANRTAAFKLLAESYPFQSNKRLLTVYDYESEAVRSMIDNSQKRGA
KVLTAEYSWPGMRVQSAKLRKMVVNKRKKKDRGLFVFPLQSTMTGTRYSYLWMTLAQANG
WHVVLDACALGAKDMDTLGLSLIRPDFLICSFYKIFGENPSGFGCLFVKKSSAKVLESST
IARSIGIASLVPVKITSQILCESSDTESETKVETKEDDLAATRSFSGPMLSQVEDGLNER
SLSLTRTDLEESEQGETSELRETEVKVEAEIVEVYSPNNFVKQENTKPNTSETDRNLVIE
CRGLDHADSLGLIKISNRARCLINWLVNALSKLQHPHSEQGLPLVRIYGPKIKFDRGPAV
AFNVFDWKGEKVEPVLVQKLADRSNISLSYGFLHNLWFSDKYEEEKQRVLETRKCEAVTI
PNNKRKEKVNKGINVVTATLSFLTNFEDVYRLWVFVAQFLDADFVEKERWRYMALNQNIV
EV
Download sequence
Identical sequences A0A2G5E1Y0
Aquca_013_00456.1|PACid:22059406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]