SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00510.2|PACid:22059560 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_013_00510.2|PACid:22059560
Domain Number 1 Region: 2231-2522
Classification Level Classification E-value
Superfamily BEACH domain 4.84e-122
Family BEACH domain 0.0000000127
Further Details:      
 
Domain Number 2 Region: 2645-2714,2751-2863,2909-2956
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.66e-27
Family WD40-repeat 0.012
Further Details:      
 
Domain Number 3 Region: 2115-2221
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-16
Family PreBEACH PH-like domain 0.004
Further Details:      
 
Domain Number 4 Region: 466-608
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000897
Family Clostridium neurotoxins, the second last domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00510.2|PACid:22059560
Sequence length 2984
Sequence
MEEETQEPGEISGKESEEIIVVEEARNSVDESVGKSPTSDHGIEQDKDSSSLLEGVSSLD
LVTSSHDVEEQFEQVSLKDQERSAFEAQSDVDLIRFSTSDNVSQSEDYNIGKAMVELDSG
LDVAGSSPGSDRQTTLKQSASSGSIESSSSLYGEIAYSSPINSPAKPKHKPTMPNVSPEL
LHLVDSAIMGKLEGMEKLKRVVSGKESFGREEEAECIAILVVDSLLATMGGVECFEEGED
NNPPSVMLNSRAATVAGELIPSLPCEGDCDVYMSPRTRMVKGLLAILRACTRNRSMCSTA
GLLGVLLQSAEKIFVQDLDSTTQISWDGSALCYCIQYLAAHSLSVIDLYKWLQVITRTLT
TVWASRLMLSLEKAMGGKESKGPACTFEFDGESSGLLGPGESRWPFSNGYAFATWIYIES
FADTLNTATAAAEIAAAAAATSGKSSAMSAAAAASALAGEGTTHMPRLFSFLSADNQGIE
AYFHAQFLVVECGSGKGKKASLHFTHAFKPQHWYFIGLEHTCKQGLLGKAESELRLYING
SLYESRPFEFPRISKALAFCCIGTNPPPTMAGLQRRRRQCPLFAEMGPIYIFKEIIGPEK
MTRLASRGGDVLPSFGNGAGMPWLATSEHVRSLAQESALLDAEIVGILHLLYHPKLLSGR
FCPDASPSGAAGTSRRPAEVLGQVHVACRMRPAEALWALAYGGPMSLLPLAVSNVHKDSL
EPLQGSFPLSSATTSLSASIFRIISLAIRYPGNNEELRRTRGPEVLSRILNYLLQTLSSL
DLGKQNGVGDEELVAAIVSLCQSQKNNYALKVQFFSTLLLDLKMWSLCNYGLQKKLLSSL
ADMVFTESSAMRDANAMQMLLDSCRRCYWVIREKDSVDSFSLQERPRPVGEVNALVDELL
VVIELLVGGAAPSLAVDDVRCLIGFLVDCPQPNQVPRVLHLIYRLVVQPNTARAHTFAES
FISCGGIETLLVLLQREAKAGDHSITDTNNEENVSVEGSVTDTSKIDEINRDEALVSSER
EKYLSHGEGFESQLSGGDRNSINVSIRNSISRRTSVSENLLLKNLGGINFSISADSARNN
VYNVDKGDGIVVRIISLLGALVASGHLKFGAHAPPNLTSGILGSGLHDGGGTMFDDKLSL
LLFALQKAFQAAPNRLMTSNVYMALLAASINASTRDDGLNIYDHGHRFEHVQLLLVLLRS
LPYASRAFQVRAIRDILFLACSHPENRVRLTSMEEWPEWILEVLISNHERGSSNYSNGVS
IGDIEDLIHNFLIIMLEHSMRQKDGWKDIEATIHCAEWLSMVGGSSTGDQRMRREESLPV
FKRRLLGGLLDFSARELQVQTQVIAAAAAGVAAEGLSPKDAKAEAEIAAQLSVALAENAI
VILMLVEDHLRLQSQLYNSSRSVEAPGSPNSSASLTGSRSSSVGRATGEALEAVAAQRLS
GDSRGLSLDVLATMADANGQISAAVMERLTAAAAAEPYESVRCAFVSYGSCASDLSDGWK
YRSRLWYGLGLSSKTSVFGGGGSGWEAWKTSLEKDEIGNWIELPLVKKSVVMLQALLLDE
SGLGGGLGIGGGSGTGMGGMAALYQLLDSDQPFLCMLRMVLVSMREDDNGEDSMFLRSGS
IKEVISEGLLWQSGSTQDESNTRLATRKPRSALLWSVLSPVLNMPISESKRQRVLVASCI
LYSEVWHAVDREKSPLRKQYLESILPPFVAILRRWRPLLAGIHELTSSDGLNPLIVDDRA
LAADALPLEAALAMISPGWAAAFASPPAALALAMIAAGAAGGETVAPAKNSQLRRDSSMF
ERRQARLHTFSSFQKPLETPSKSPAVPKDKAAAKAAALAAARDLERNAKIGSGRGLSAVA
MATSAQRRGATDMERVKRWNDSEAMATAWIECLQSVDTKSVSGKDFNVLCYKYIAVLVAS
FALARNMQRLEIDRRTQVDVIHRHRLCTGSRAWRKLIHCLIETRVLFGPFGEHLCNPERV
FWKLDIMESSSRMRKCLRRNYRGSDHLGASANYEDQLQKRDGQENVICPTTILAAEAISL
EETHEDDEQTETNNLGGTPRSSGHDEDKQQSPSAYIEEPGQISGDPVAARISSDQDLVQT
PSPVAPGYVPSENDERIILELSSSMVRPLKIIRGTFQITTRRINFIVNDHDDNVMEDGND
TSSRNRDRERDRSWLMSSLHQMFSRRRSALELFMVDRSNFFFDFGSIEGRKNAYRAIVQA
RPPHLNNIYLATQRPEQLLKRTQLMERWARWEISNFEYLMQLNTLAGRSYNDITQYPVFP
WILADYSSEYLDLENPSSYRDLSKPVGALNADRLIKFQERYASFDDPVIPKFHYGSHYSS
AGTVLYYLVRVEPFTTLSIQLQGGKFDHADRMFSDIGATWNGVLEDMSDVKELVPELFYL
PESLTNVNSIDFGTTQLGGKLDSVKLPSWAENSVDFIHKHRKALESEHVSAHLHDWIDLI
YGYKQRGKEAISANNVFFYITYEGTVDIDKISDPVQQRSTQDQIAYFGQTPSQLLTVPHL
KRRPLADVLHLQTIFRNPSEIKSYVIPNPERCNVPASAIYASSDSVIVVDVNAPAAHVAL
HKWQPNTPDGQGTPFLFQHAKAIGNSTGGAFRRMFKGPVSSGSEDLQFPQALAFSATGIR
SSSVVAVTCDKEIITGGHADNSVKLISSDGAKTIEAAEGHCAPVTCLALSPDSNYLVTGS
QDTTVILWRIHRASASQSSGISEPPTSSSTPSSSSGTYSNNIADSSRRRIEGPMHVLRGH
LREITCCCVNSNLGIVVSSSFSSGVLLHSIRRGRLIRRLVGVEAQLVCLSSEGVIMTWNK
LDQRLCTFTINGVPIATANLSSFSGTISCMEVSVDGESALLGTSVFSENGGSCYDTSGEL
RLYKQNADNLGLETDRENTDKRIELSAPSISFLDLHTLKVFHTLKLQEKQDITTLALNRD
NTNLLVSTADRQLIVFTDPTLSLRVVDQMLKLGWEGEGLSPLIK
Download sequence
Identical sequences A0A2G5E2R0
Aquca_013_00510.2|PACid:22059560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]