SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00555.1|PACid:22058743 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_013_00555.1|PACid:22058743
Domain Number 1 Region: 52-93
Classification Level Classification E-value
Superfamily F-box domain 0.00000576
Family F-box domain 0.0063
Further Details:      
 
Weak hits

Sequence:  Aquca_013_00555.1|PACid:22058743
Domain Number - Region: 245-407
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0314
Family Quinoprotein alcohol dehydrogenase-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00555.1|PACid:22058743
Sequence length 421
Sequence
MEHKSVRIIKIHLGLFPSMKLIIHIDQKSIKVFFNNLGHFNYLLPSTFDTKERNWLDLPD
HILNCISDLLIDINDYIRFGAVCRPWRYIYIENLRRHTTHRQLPLLMIPSEPCDLQNQTR
SLYSLSENRVIPNFQIRLPHNKFCRGSSEGWLVVLDDNCTDVYLFNPFLSVDNKLELPHL
TEFPHEEDEIFEGFLTKAVLSANPTSSFTNYVVMAIYGQYARLAFFKPGDKTWTPLDFEY
MVIEDVIYFNDQFFAVNFEGTVFAFDVNHHHLKQAELAPPPGNNIDTRKFLVNSLGNLLL
VRRLMKRSEGEYCTTGFEVFKLDEFTRNWVQVESLGDQTLFLGDNTSISISSSHYYGCKR
NCIYFTDDYFEGYWVDKLSGPSDIGVFNLEDGSIKQHYPLKSNIVFPPPIWIEPTLQRCF
N
Download sequence
Identical sequences A0A2G5E293
Aquca_013_00555.1|PACid:22058743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]