SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00558.2|PACid:22059376 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_013_00558.2|PACid:22059376
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.42e-40
Family Cyclophilin (peptidylprolyl isomerase) 0.0000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00558.2|PACid:22059376
Sequence length 111
Sequence
MIQGGDPTGTGKGGTSIWGKKFNDELRESLKHNARGILAMANSGPNTNGSQFFITYAKQP
HLNGLYTVFGRVIHGFEVLDIMEKTQTGPGDRPLAEIRLNRVTIHANPLAG
Download sequence
Identical sequences A0A2G5E2B7
Aquca_013_00558.2|PACid:22059376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]