SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_014_00099.1|PACid:22028680 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_014_00099.1|PACid:22028680
Domain Number 1 Region: 674-950
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-72
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 243-566
Classification Level Classification E-value
Superfamily RNI-like 3.53e-57
Family 28-residue LRR 0.013
Further Details:      
 
Domain Number 3 Region: 57-327
Classification Level Classification E-value
Superfamily L domain-like 1.02e-50
Family Polygalacturonase inhibiting protein PGIP 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_014_00099.1|PACid:22028680
Sequence length 968
Sequence
MEEKLKLWVHFILATLFFFPPSTSLTVETEALLQFKKQLKDPFNTLESWKPDSKHAPCDF
IGITCDKNSHLVTHISLENKSFSGEISPSISALKSLTSLVLASNTISGSLPFELVNCSNL
EILNITGNELTGSIPDLSSLRNLRILDLSFNYFSGRFPDWVVNLKSLTALGLGQNDYDEG
QIPENIGNLKNLTWLYLPGSNFSGEIPDTILELESLETLDLSDNMLSGNFPKAIPKMRSL
NKIELWKNNLTGEIPKELAELIHLREFDISKNNMYGNLPTEIGSLKNLVVFQLYENNFTG
EFPQGFGDMRYLNGFSIYRNSFSGSFPENFGRFSPLNSIDISENKFSGDFPRFLCENKQL
QFLLALDNNFSGVLAESYGECKSLERLRISKNHLSGSIPSGVWGLPLVQMIDLGDNGFSG
GISSEIRMSTSLTQLLLQNNKFEGPLPSELGELTLLEKLSAYNNLFTGKVPAEIKKLKNL
SSLHLEENSLTGSIPSEVGECIRLADLNLAKNELSGDIPKTLSSLSNLNSLNLSQNRLSG
SIPWNLQRLKLSSIDLSGNKLMGRIPFDLAMTGGDQAFSGNAGLCIDNDLGDHVKSRISV
CKRSQNHKSTLKHKLLLGGVISLALVAIIAGLLLLSYKNFKLNESREEGDLEGKLEKDPC
WKLEAFHPMELDEDEICDLKEDNLIGSGSTGKVYRLDLKKSSGTVAVKQLWKGKEVKLLT
AEMEILGKLKHRNILKLYAFLMKGESNFLVLEYMENGNLFQALRREIKGGRAELDWIQRH
KIAVGAAKGIAYLHHDCSPAVIHRDIKSTNILLDDDYEPKIADFGIARIAQNSINSLDTS
SFAGTHGYFAPELAYSLKVTEKSDVYSFGVVLLELVTGRSPIEAEFGEEKDIVYWVSTHL
SSRDDILKVLDQKVSGTAEDDMIKVLRIATLCTTKLPSLRPTMRDVVKMLIDADPCNIII
AEKNLDKY
Download sequence
Identical sequences A0A2G5DUJ3
Aquca_014_00099.1|PACid:22028680 Aquca_014_00099.2|PACid:22028681 Aquca_014_00099.3|PACid:22028679 Aquca_014_00099.4|PACid:22028682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]