SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_014_00707.1|PACid:22027965 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_014_00707.1|PACid:22027965
Domain Number 1 Region: 65-108
Classification Level Classification E-value
Superfamily F-box domain 0.000000484
Family F-box domain 0.0057
Further Details:      
 
Weak hits

Sequence:  Aquca_014_00707.1|PACid:22027965
Domain Number - Region: 216-291
Classification Level Classification E-value
Superfamily gene 59 helicase assembly protein 0.0785
Family gene 59 helicase assembly protein 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_014_00707.1|PACid:22027965
Sequence length 453
Sequence
MGINWFDKVVGLFPCFPRIYCMCFSNSPISACFYLLLDIILSYRGVHSQISTTSFEKHDV
DSFSLSSVNWLDLPDHLLSEIANRLNSLKDLIQFGAVCQSFRSIYIDSPRCMSPRVPFLM
LATELNHDDQTRSFYSLITKTVSNSQLQVPHNRYCPGSSHGWVFTVCHETLQVRLLNLFS
SSTGGENEIYLPPITAFEYDPIITYMYPGFVHKLVLSANPALQPNYAIMAICNAASLLAF
YKPGDQAWTTLDSKFKSNVDLIYYKDRFYALDIMGDVFSIDLNDPEPKILPVGLPRPPYK
RGDKRYLVESSGDLLQVVRYVEFEGFEDDEDDIYGWEIPPNYFTKRMHVFKLDQKVTCKW
IPVDNLDGRILFLGDNSSLSVSASDFPECEPNSIYFTDDYYNAYEEKEKYGFGPHDMGVF
SLEDHTIKHHYPTESNLIYPAPIWIEPPLVHYH
Download sequence
Identical sequences A0A2G5DXR8
Aquca_014_00707.1|PACid:22027965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]