SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_015_00152.1|PACid:22041723 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_015_00152.1|PACid:22041723
Domain Number 1 Region: 22-102,147-281
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.29e-24
Family WD40-repeat 0.021
Further Details:      
 
Weak hits

Sequence:  Aquca_015_00152.1|PACid:22041723
Domain Number - Region: 914-985,1400-1427
Classification Level Classification E-value
Superfamily TPR-like 0.0123
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_015_00152.1|PACid:22041723
Sequence length 1614
Sequence
MEWNTLQHLDLRHVDRGLKPLQPHAATFHPNQALIAVAIGNFIIEFDALTGSKISTINIG
APVVRMLYSPTSGHAVIAMLEDCTIRSCDFDTEQTCVLHSPEKRMEHISSDTEVHLALTP
LQPVVFFGFHKRMSVTVVGTIEGGRAPTKIKADVKKPIVNLACHPRLPVLYVAYAEGLIR
AYNIHTYAVHYTLQLDNTIKLIGAGAFAFHPTLEWIFVGDRRGTLLAWDVSVERPNMIGI
TQVGSQPVTSIAWLPMLRLLVTLSKDGTLQVWKTRVIINPNRPPMQANFFEPAAIESIDI
TKVLSQCGGEAIYPLPRIKSLVVHPKLNIAALLFANLTGGDNLKNRAAYTREGRKQLFAV
LQSARGSSASVLKEKLSSLGSSGILADHQLQMQLQEHHLKGHGPLTISDIARKAFLHSHF
MEGHSKSGPISRLPLITISNANHLLKDVPVCQPYHLDLNFFNNKANRVLHYPARVFYVDG
VNLMAHNLCSGADSIYKKLYTSVPGNVECYSKRMFYSAKQHLFLVIFEFSGASNEVVIYL
ENTDPQAANSKESTVKGRDAAFIGPNDNQFAILDDDKISLTLYILPGSASKEVGESNGGV
AVDSSTNTNVGSVKGPLPFMFEAEVDRIFSSPLESTIMYASNESHIGMTKLIQGYRLSVD
NGQQVTPESKGKKTIKLKVNETVLQVHWQETLRGHVAGILTSHRVMIVSADLEILASSYT
KFDKGLPSFRSLLWVGPALLFSTATAISVLGWDNKVRTILSISIPNSVLVGALNDRLLLA
NPTEVNPRQKKGVEIRSCLVGLLEPLLIGFATMQQTFEQKLDLSEILYQITSRFDSLRIT
PKSLDILARGSPVCGDLAVSLSQAGPQFTQVLRCIYAIKALRFSTALSVLKDEFLRSRDY
PQCPPTSHLFHRFRQLGYACIRYGQFDSAKETFEVIADFESTLDLFICHLNPSAMRRLAQ
KLEDLGTDSELRRYCERILRVRSSGWTQGIFANFAAESMVPKGPEWGGGNWEIKTPINLK
DIPQWELAGEVMPYMKTNDGSIPSIIADHIGVYLGAIKGRGNVIEVREDSLVSAITAAGA
DNKLNGFQSVLQPVPGRPKGVGDTNANGNSLMGLGTLKTQMAGGTAADEQARAEEEFKKS
LYGAVADGSSSDEEGVSKSKKIRIRIRDKPTEGATVDVNKIKEATKQFKLGEGLGPPMSR
TKSSSGGSQDLSLILTQPVSAASTIATVPPVSAPSDFFGTDSLAQPAPTTQPGAGGVSAG
PIPEDFFQNTISSLQVAATLRPPGVVISKLDQTSQGPAANQANVDGDFSLPGGGVPPQAP
VQPGVPLENVGLPDGGVPPQSLGQAGSLQQPRAQAAHAQVASQPIDLSSLEGPGSGKPPA
RPTSPPSNVRPGQVPRGAAAPVCFKTGLAHLEQNQLADALSCFDEAFLALAKDQSRGADI
KAQATICAQYKIGVSLLKEIGRLQKVSGPSAISAKDEMARLSRHLGSLPLLAKHRISCIR
TAIKRNMEVQNYAYAKQMLELLYSKAPASKQEELRSLIDMCVQRGLSNKSIDPLEDPSQF
CAATLSRLSTIGYDVCDLCGAKFSAVTAPGCIICGMGSIKRSDAIAVPVPSPFG
Download sequence
Identical sequences A0A2G5DSE4
Aquca_015_00152.1|PACid:22041723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]