SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_015_00201.3|PACid:22042202 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_015_00201.3|PACid:22042202
Domain Number 1 Region: 10-208
Classification Level Classification E-value
Superfamily 14-3-3 protein 5.36e-81
Family 14-3-3 protein 0.0000000701
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_015_00201.3|PACid:22042202
Sequence length 213
Sequence
MASITEGNLSREQYVYLAKLAEQAERYEEMVSFMEKLVVGSASVNELSVEERNLLSVAYK
NVIGSLRAAWRIVSSIEQKEEGRKNDEHVVLVKDYRSKVESELTNVCAGVLKLLDAHLIP
SATTSESKVFYYKMKGDYHRYLAEFKTGAERKDAAEDTMLSYKAAQDVALADLAPTHPIR
LGLALNYSVFYYEILNSSEKACSMAKQVWLFTC
Download sequence
Identical sequences A0A2G5DSL4
Aquca_015_00201.2|PACid:22042201 Aquca_015_00201.3|PACid:22042202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]