SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_015_00396.2|PACid:22041768 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_015_00396.2|PACid:22041768
Domain Number 1 Region: 25-206,239-366
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.61e-45
Family WD40-repeat 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_015_00396.2|PACid:22041768
Sequence length 368
Sequence
MAKTTLGCEPVIGSLTLSTSNKKDYRITNRLQDGKRPLYAVVFNFVDSRYFNVFATAGGH
RVTVYHCLDNGVIAVLQSYVDEDDESFYTLTWACNAEGNPLLVAGGLNGIIRVIDTSSEK
IHKSFVGHGDSVNEVRTHPLKPSLVVSASKDESVRLWNVDTGVCILIFAGAYGHRNEVLS
VDFHPSDMYKIASCGMDNTVKIWSMEEFWTSVEKSFTWTDLPSKFPTKYVQFPIMLASIH
SNYVDCNRWLGDFILSKSVDNEIVLWEPKPKEGTPMETEVDILQKYPVPECDIWFIKFSC
DYHYKTAAIGNREGKIFVWELQSSPPVLIARLSYVHSKSPIRQTAMSFDGSTILACTEEG
QIWRWDAI
Download sequence
Identical sequences A0A2G5DTI9
Aquca_015_00396.2|PACid:22041768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]