SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_015_00459.1|PACid:22041847 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_015_00459.1|PACid:22041847
Domain Number 1 Region: 93-168
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000000705
Family WD40-repeat 0.0055
Further Details:      
 
Weak hits

Sequence:  Aquca_015_00459.1|PACid:22041847
Domain Number - Region: 167-188
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00267
Family alpha-mannosidase, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_015_00459.1|PACid:22041847
Sequence length 189
Sequence
MGHIANAFRHLLNYVAQVLLTLPYSFSQLGMQSGILFQLFYGLLGSWTAYLISVLYVEYK
TRKEREKVDFRNHVIQWFEVLDGLLGKHWRNVGLASGGNDNRLFVWNQHSPQPVLKYCEH
TAAVKAIAWSPHLNGLLASGGGTADRCIRLWNTSTNSHLSCMDTGSQVIVVYNSLGWQRE
DIVRIPVSM
Download sequence
Identical sequences A0A2G5DTV3
Aquca_015_00459.1|PACid:22041847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]