SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_016_00052.1|PACid:22062538 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_016_00052.1|PACid:22062538
Domain Number 1 Region: 846-1156
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.17e-65
Family Protein kinases, catalytic subunit 0.00041
Further Details:      
 
Domain Number 2 Region: 178-493
Classification Level Classification E-value
Superfamily L domain-like 1.51e-62
Family Polygalacturonase inhibiting protein PGIP 0.06
Further Details:      
 
Domain Number 3 Region: 467-793
Classification Level Classification E-value
Superfamily L domain-like 4.08e-58
Family Polygalacturonase inhibiting protein PGIP 0.0049
Further Details:      
 
Domain Number 4 Region: 58-230
Classification Level Classification E-value
Superfamily L domain-like 4.25e-26
Family Polygalacturonase inhibiting protein PGIP 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_016_00052.1|PACid:22062538
Sequence length 1168
Sequence
MGFQNVILILVLVCFVIDINVSVGETSFRVEIEALKGFKSLISHDSVEVLADWIDENHHC
NWTGISCNPLSNRVVSISLLGKQLKGEISPFLGNISSLQVLDLTSNLFTGMIPSQLGRCL
ELIELVLYDNSLSGSIPRELGYLRNLELLDLGANRLNGSIPDGICNCTSLGGLGVIVNNL
TGMIPSCIGNLANLQIISAFTNKFVGSIPLSIGKLVNLQSFDLSQNQLSGVIPSEIGNLL
ELQYLQLYENQIVGNIPPELGRCEKLVYLNLYTNQLNGSIPSQLGNLLNLQMLRLYDNRL
SSTIPPSLSKCISLTRLGLSENELSGQIPPELGHLRSLESLTLHSNNLSGNIPASLMDLT
NLTYISLSFNSLEGEIPKNLGSLHNLKALVLSNNLLEGSVPSSISNCIHLENITLSYNRL
TGQIPVGFGNMRNLTFFSVGANHMSGSIPEDLYNCVNLHNLDVARNSFTGSLKRSIGRLS
RLRILHMHVNSLSGTIPREIGNLSQLISLELARNRFSGLIPSEISKLSFLQGLALGENFL
EGQIPEQISEAKQLVELQLQLNRLTGPIPDDLSKLEWLSYLDLHGNNLNGSIPRNLGYLN
RLSKLDLSHNHLTGSIPGAMLEAMKNMQIYMNLSNNVLSGSIPEELGGMEMVQALDMSNN
NLSGSIPITLRGCKNLVLLDLSGNKLSDRIPSDIFSELDLLISLNLSANSLSGELPGDIA
KLDDLTSLDFSRNNISGSIPISFSNFTNLKYLNLSFNQLEGPVPTTGIFRNLSLMSLGGN
PGLCGSNFLRPCYREGQSNTHRRFSKKAVLILIVLGSIFASLLLLSAILVYRRCFEKQKT
ETAENSEPQYYLAPSWKRFNRKDLETVTNFFDEGNVIGRSASSTVYKGRLGNGEVAVKRL
SLLQFSAVSEKGFDRELSTLSHIKHRNLVKMIGYAWESGKIKALVLEYMVNGSLESVIHD
PGTNRSRWTFSERLKVCVSVANGLVYLHSGYGDPIVHCDLKPSNILFDGDWEAHVSDFGT
ARMLGFNLQDESGSSSSSAYQGTIGYLAPEFAYGSKITTKADVFSFGIVMMEFVTRRRPT
GTIEDNGFPITLRQFVEAAHANGFQRLLQVMDPDLASSLLTQNDEKRMVDLLELALSCTQ
AAPENRPDMNVVLSLLLTISESKYFPKD
Download sequence
Identical sequences A0A2G5DQ08
Aquca_016_00052.1|PACid:22062538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]