SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_017_00014.3|PACid:22032484 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_017_00014.3|PACid:22032484
Domain Number 1 Region: 87-123,286-520
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.33e-20
Family WD40-repeat 0.014
Further Details:      
 
Weak hits

Sequence:  Aquca_017_00014.3|PACid:22032484
Domain Number - Region: 6-119
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0198
Family WD40-repeat 0.045
Further Details:      
 
Domain Number - Region: 166-193
Classification Level Classification E-value
Superfamily NRDP1 C-terminal domain-like 0.0863
Family USP8 interacting domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_017_00014.3|PACid:22032484
Sequence length 938
Sequence
MVSPFQTATLVARPSYPNSIAWSHENLVAIASGHLITILNPALLFGPRGLITIPPIKPFP
IGVVSREDLLTECLLPTCLSRDTRPCARSIAWSPLGLAPNSGCILAVCTTEGRVKLYRQP
FIEYCAEWVEVIDITDLLFDHLVRSGFGEADLPFTKASCEEAAECQRESACGSHLKNSML
NKGHKRRWVEGLCVGFSEQGLLVKLSGESGSVTLDARSVRLAPLWNCGLNLWQVTIPKIE
MEDLELAKVVKSKTKRFKENNLRRCSSVPKHQGKSDKQRSVNGTISEITARQYVSCNAML
SSTVVAWSPMLHLSSESDSSHLNSSPSDLSLLSVGGKSGKLSLWRIYEPQRYSIVHNDVS
VNVSLVGLLQAHNKWITSICWKSLSTNGSNSQVALATGSSDGSVKVWLVDTERLLNSSES
NNSSICLLKEVTSASSAPVSVLSLTASAESPEKMLLAVGRGSGSLEVWICDISNFKFQII
GSYDAHVQVVTGLTWAFNGHCLYSCSQDDSVRSWVIQGSSLYEAQIPSGSLGIRSSTDLP
NVSDSCFGLAISPGNLVIAVVRGLDTELLNQMYQARSQKAAVEFCWIGGQQLESSSDKNL
ELGVETIPGISEREMACWESNMLWSLKQYQHLDNLLVVWDVIVALFAVEYSAQNYVQRIL
AKWLSSWFAGCDVGCSIEKILLYASRCLYKISTRQLHLLNIICRRFVLSGLKGDIPNVQA
MLLEGVGVEDERLKLWIDILDISERELRERLVAFSFAFLLSQASSSTTIIPIDRQWLPAG
IAQMEQWVAKNHDSVQDNLKILASKLEKLGKRLHSICGYVAEEQCKFCSASAPFDSPEIA
FCVGVSCNTGVGQSHKLVRCAASMQLCPTTPLWYCVCCQRFVSELAPRSLFTLSELPIDL
KSFMRSSSRQLALRPLCPFCGILLQRLQPEFLISPSPV
Download sequence
Identical sequences A0A2G5DKT3
Aquca_017_00014.3|PACid:22032484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]