SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_017_00040.3|PACid:22031905 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_017_00040.3|PACid:22031905
Domain Number 1 Region: 14-254
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.68e-37
Family Cell cycle arrest protein BUB3 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_017_00040.3|PACid:22031905
Sequence length 255
Sequence
MSAIVPPPPAPGKELLNPPRDGISNLRFSNHSDHLLVSSWDKSVRLYDATSNVMMGEFLH
GGPVLDCCFHDDSSGFSASADNTVRRYVFSSGKEDILGRHEAPVRCIEYSYAAGQVITGS
WDKTVKCWDPRGASGKERTLVGTYPQPERVYSLSLVGNRLVVATAGRHVNVYDLRNMSQP
EQRRESSLKYQTRCVCCYPNGTGFALSSVEGRVAMEFFDLSEAGQAKKYAFKCHRKSEAG
RDTVYPVNAIAFHPM
Download sequence
Identical sequences A0A2G5DKV2
Aquca_017_00040.3|PACid:22031905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]