SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_017_00108.1|PACid:22032081 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_017_00108.1|PACid:22032081
Domain Number 1 Region: 363-433
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000157
Family F-box domain 0.0037
Further Details:      
 
Domain Number 2 Region: 1-72
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000691
Family Ubiquitin-related 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_017_00108.1|PACid:22032081
Sequence length 492
Sequence
MKLRIRSLESRETLKIEIPSPSSLQDLKQVIAEKISFSLESLHLSLNRKNEIIASPIDTL
NTLGIASGDLIYYTRHANVFESETPIQNPVPRVENQPIEVSNPEETLETMNAIDGKMETL
DASIVPQVPKTLETMNTSDGKIETLDPLIVPQVPETLEIHESTEVKPVDTCEEIDTEAEN
LGDSISSAPGFLQKVYKAEVGNINNNEHKMLISAVHAVLLEFGFVCVDSITGKKINGYHL
PEGWDLKTSIMSVKYTLPALVRHGEEVVETVILKFNPMGKFVSVYGSLSFKESISLKLNA
SRFVPSINYLCGSNCVLTGGKSLIVGAKSVYERKVFELWKTVKDRLAIPLSIDLCVKTGL
ELPPCFMRLPTEVKMKIFELLPGIDILKVGSLSSELRYLSSNDDLWKQKCVEEFSFSKSS
GGPQSDWKKKYINVKKTTMGSRRSISQPRRPIFQPYPWLPNRRQSRPIPVPHFPVISGGE
SDLYPLGYRSYF
Download sequence
Identical sequences A0A2G5DLB3
Aquca_017_00108.1|PACid:22032081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]