SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_017_00115.1|PACid:22031524 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_017_00115.1|PACid:22031524
Domain Number 1 Region: 367-632,849-967
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.47e-45
Family Quinoprotein alcohol dehydrogenase-like 0.037
Further Details:      
 
Domain Number 2 Region: 926-1124
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0000000000000471
Family Quinohemoprotein amine dehydrogenase B chain 0.049
Further Details:      
 
Weak hits

Sequence:  Aquca_017_00115.1|PACid:22031524
Domain Number - Region: 335-382
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00641
Family Soluble quinoprotein glucose dehydrogenase 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_017_00115.1|PACid:22031524
Sequence length 1147
Sequence
MTSLSRELVFLILQFLDEEKFKDSVHKLEQESGFFFNMKHFEERAQAGDWDEVERYLSGF
TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVEILVKDLKVFSTFNEELLKEITQLLT
LDNFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLVFPTLKQARLRTLINQSLN
WQHQLCKNPRPNPDIKTLFTDHSCAPTNGTRAATPVALPVGAVAKPATYANLGVHGMQPF
PPPTAAAANANALAGWMANATASSSVQSAVVAASSIPMLQNQGSIVKRPRTPPTSLGMVD
YQSAEHEQLMKRFRSAAQPINDEASYPGPHQNVSWTMDDLPRTVVCSFHQGSSVTSIDFH
PSHHTLVLVGSANGETTLWDIGLRERLVSKPFKIRDIEACSLPFQTSYLKDSTISITRVA
WSPDGNLMGVAFSKHLIHLFDCQGPNDLRQLLEIDAHVGSVNDLAFSYPNKQLCVVSCGD
DKQIKVWDLTGRRLYNFEGHDAPVYSVCPHHKETIQFIFSTATDGKIKAWLYDNMGSRVD
YDAPGHGCTTMLYSADGTRLFSCGTSKEGDSFLVEWNESEGAIKRTYSGFRKKSAGVVQF
DTTQNRFLAAGEDHQIKFWDMDNTNILTSTEAEGGLASLPRLRFNKEGNLLAVSTADNGF
KILANTEGLRSLRVFGRSIEGLRLHNEASAVKIPGPSAVANVSPAISKVERLDQTSPARP
SPVCNGGDPSIRSVEKTRTLEDAPDEGKFRELTEIVDPLKCRVVTMPDSADASNADPASK
VSFFQVARLLYTNSGGGILALGVNGMQKLWKWSRSERNPNGKATASIVPQQWQPNSGLRM
NNDISDVNLEEAVPCIALSKNDSYVMSACGGKISLFNMMTFKVMTTFMPPPPAPTFLAFH
PQDNNIIAIGMEDSTIHIYNVRVDEVKTKLKGHQKHITGLAFSTNLNILVSSGADAQLCT
WNTDTWEKRKAITIEVPAGKVAIGDTRVQFHSDQIRLLVFHETQLAIYDASKMECIHQWI
PQEVLSAPISYAAYSCNSQLIYAAFCDGNVGVFDAENLRLRCRIAPSAYLSQAVLNSQNM
RPLVIATHPHEPNQLAIGSTDGTVKVIEPSESDGSWIATAPSANGLLNGRTAASSATIKR
DPEQLQR
Download sequence
Identical sequences A0A2G5DLA0
Aquca_017_00115.1|PACid:22031524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]