SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_017_00121.1|PACid:22032083 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_017_00121.1|PACid:22032083
Domain Number 1 Region: 523-709
Classification Level Classification E-value
Superfamily Smc hinge domain 1.16e-41
Family Smc hinge domain 0.0012
Further Details:      
 
Domain Number 2 Region: 27-243,1142-1228
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.57e-38
Family ABC transporter ATPase domain-like 0.00039
Further Details:      
 
Domain Number 3 Region: 906-963,1045-1242
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.92e-34
Family ABC transporter ATPase domain-like 0.0000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_017_00121.1|PACid:22032083
Sequence length 1252
Sequence
MGIPTEPTPDSESIPSRDLKSSRKPRLFIKEMVMRNFKSYADEQRVGPFHKSFSAVVGPN
GSGKSNVIDAMLFVFGKRAKQMRLNKVSELIHNSTNHQNLDSASVSVHFQEIVDLDDGNY
EAVPGSDVNITRVAFKDNSSKYYINDRGSNFTEVTKKLKGKGVDLDNNRFLILQGEVEQI
SLMKPKAQGPHDEGFLEYLEDIIGTDKYVEKIEESYKQLEALNEKRSGVVQMVKLAEKEK
DNLEDGKNEAESYMLKELSHMKWKEKATKLAAEDATSHVVELQTNMSTMEDNLKNEREKI
KGTAKTLKDLELMHNKNMKRHEELDNDLRTCKDQFKEFERQKLKHQEDFKHMKQKIKKLG
DTLKRDASKEEETLKESAESTDLRKKLEEEIPKLQKILLDEERVLEEIKEISKVETGMFR
SELMEVRAELEPWDKQLIEHKGKLDVACAESKLLKDKHEDGRKAFEDAQQKMRNIKDEIK
SKNEVIEKIHSSLNKHKSEAAEAREVEKECIKEQESLVPLEQAARQKFTELVSVMESERS
QSSVLKAILQAKESNEIKGIYGRLGDLGAIEGKYDVSISTACSGLDYIVVETTDSAQACV
ELLRRKNLGVATFMILEKQADHKLDEIVHPPEGVPRLFDLVTAPCRQIKKAFFAALGNTV
VAKDLDQATRISYGGNKEFGRVVTLDGALFEKSGTMSGGGNKPRGGKIKLSIQTTSVSGE
TVANVSGETVANAEKELTKLVDQLSGLRQRIAEAMRQYLASEKTMAHSEMDLARAQKEID
SLNEQHSYIEKQLDSLKAASQPRSEELARLVELKNTISAEEKELERLTTGSMKLNEKALE
LQSKIENAGGEKVEKQKAKVNKILSDIDKNNTEINRCKVLDLTGEKMIKKLRKGIEESNK
EKERLIGEEENMCSIFKEIKQKAFTVEDNYKKTQELIDQHKETLDGTKEEYHKLKKTMDE
MRASEVDIDYKLQDMRKLSKECEQKAKAYKEKLDDIQSNLVKLLEQIQKDAVDLEKLQAT
LGDETLKEPCNLKRALEMTALLEAQLKEMNPNLDSISEYRKMASLYSERVEEINKVTQER
DDLKKYYDELRKKRLDEFMAGFNTISLKLKEMYQMITLGGDAELELVDSLDPFSEGVVFS
VRPPKKSWKNIANLSGGEKTLSSLALVFALHHYKPTPLYVMDEIDAALDFKNVSIVGHYV
KDRTRDAQFVIISLRNNMFELADRLIGIYKTDNCTKSITINPGSFAISEKAA
Download sequence
Identical sequences A0A2G5DLE0
Aquca_017_00121.1|PACid:22032083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]