SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_017_00188.2|PACid:22032289 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_017_00188.2|PACid:22032289
Domain Number 1 Region: 17-267
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.19e-66
Family Capz alpha-1 subunit 0.000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_017_00188.2|PACid:22032289
Sequence length 275
Sequence
MAEDEEYEEGSEPEEELSDKQKIEIAKWFLTNSPPGEIQYVAKDVRSVLTDEHLYNMAVS
EAFPIYNKTHIISLELPDKSGDVLITTYGELNETEYLDPRTAQVATVDHVKQVCTEVRPA
MDEELPSPYIEEFRCALDAEIIKYVAEAYPKGICSVYCINGKDVEGPGSDFELAVLISAA
RHSPQNFCNGSWRSIWNVEFKDDMQMIELRCTMQVGAHYFEEGNVQLDANHECKDSTIFQ
SPDDCAISITNIIRHHETEYLASLEVSIKLSIFSE
Download sequence
Identical sequences A0A2G5DLM3
Aquca_017_00188.2|PACid:22032289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]