SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_017_00689.1|PACid:22031310 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_017_00689.1|PACid:22031310
Domain Number 1 Region: 665-990
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.63e-64
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 359-610
Classification Level Classification E-value
Superfamily L domain-like 2.98e-60
Family Polygalacturonase inhibiting protein PGIP 0.00028
Further Details:      
 
Domain Number 3 Region: 14-272
Classification Level Classification E-value
Superfamily L domain-like 2.04e-51
Family Polygalacturonase inhibiting protein PGIP 0.0017
Further Details:      
 
Domain Number 4 Region: 249-369
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000122
Family Polygalacturonase inhibiting protein PGIP 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_017_00689.1|PACid:22031310
Sequence length 1002
Sequence
MNLSSAYAHVLGNETDRLALLAIKDKITQDPSGILYSWNKSIHFCNWEGVICSQRHQRVI
MLDLMSKGIIGSLSPYIGNLSFLRTIDLRNNSFHSQIPHEIGRLFRLQILLMGNNSFSGQ
LPTNLSQCSNLINFTIGHNNLVGEIPMDFGSLSKLIALGLHDNNLTGRIPASFGNLSSLE
ALGLTSNKFYGSIPGSITQLQSLLYISLADNMFSGMVPQSFYNISSLQYISFAKNQLEGS
LPPEIGLNLPNLFGFLIGGNQFSGSIPISLVSNASKLQNLDLAYNSFTGNVPIEVGSLQD
LQVLALGTNGLGGGGKDDDMKFLTSLNNCSNLQLLDIYGNQFGGRLPISVVNLSNTFGYL
YLGNNQIVGSLPSEIGNLVNLMLLSVEMNFLTGIIPKGIGMLQNLQYLGLSGNRFSGQIP
DSVGNNSQLYYLDLSDNKLEGNVLSNFEKYQSLQILNLSHNHFTGTIPKKLFELSGHLTT
LSLAHNSLFGQIPSEVGNLQNLQSLDISENKLTGDIPVTLGDCLSLESLYLQGNILGGVI
PSSLSHLKGLKNFDISRNNLSGDIPKYLENLLLLKSLNLSFNNLEGEVPTKGIFQNASAI
SLVGNSKLCGGMAKLELEKCYFKKSEKHGMHLALKVALGVLLPSLVIASLLLAFCFTRRP
GTRPSSEEFLKDGLERISYNELRKATDGFSLSNLIGVGSYGSVYKGVLHQNEGPIAVKVL
NLMETGASKSFIAECEVLRKVRHRNLLKILTVCSSVDFEGNDFKALVFKFMHNGSVEDWL
HPSSDSVLLPRYLNLWQMLNIAIDVAFALDYLHNHCEIPIVHCDLKSSNILLDHDMAARV
GDFGLAKFLRKTSSGSGTNESNSFAVRGTIGYIPPEYGMGAQVSTQGDLYSYGIFLLEML
TGKRPTDMMFKDGVNLHQWTRLALTDQGVMDIIDTRLVSEGDPNETTYDSDMHKYTREQL
QECIISIMNIGVACSAESIVERMEIKDVLAQMHAIKKKFAQI
Download sequence
Identical sequences A0A2G5DP95
Aquca_017_00689.1|PACid:22031310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]