SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_017_00733.1|PACid:22031351 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_017_00733.1|PACid:22031351
Domain Number 1 Region: 481-680
Classification Level Classification E-value
Superfamily Smc hinge domain 1.06e-47
Family Smc hinge domain 0.00046
Further Details:      
 
Domain Number 2 Region: 9-264
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.14e-42
Family ABC transporter ATPase domain-like 0.000029
Further Details:      
 
Domain Number 3 Region: 823-897,985-1200
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.54e-28
Family ABC transporter ATPase domain-like 0.00000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_017_00733.1|PACid:22031351
Sequence length 1209
Sequence
MPSLVSPGKILRLELENFKSYKGFQIIGPFYDFTAVIGPNGAGKSNLMDAISFVLGVRTG
QLRGTQLKDLIYAFDDKEKEEKGRRAFVRLVYQLGNGIELQFMRVITSSGSSEYRLDGKI
VSWEDYNNKLKSLGILVKARNFLVFQGDVESIASKNPKELTGLLEQISGSDEYKRRYEEL
EDEKARAEENSALVYQKKKTITAERKQKREQKEEAEKHLRLQEQLKSLKTEHMVWQLSNI
DKDMYDANKEIEDKKRSREDTLKEQMEHEVEENSKKMEQAGYLKEITLCDKNIADKKSKL
DKKQPELLKYKEEISRINSKINSKRKDLDKKREEQRMHTEEISKLKKDLRDVTEKRDDLY
GKDRGGAEKLQLADNQREEYNRIKQKAGTKTAKLREEKDVQDRQQHADIKAQDNLEENLQ
QLRNREQELVSQEEQLQTKLKDVVDAFRKHGKELARVQKELKEMQDKHRESRNKYEFLKV
KVGEIEDQLRQLKADRHESDRDKRLTEAVQNLKELYPGVYGRMTNLCGPTQKKYNLAVTV
AMGRFMDAVVVEDEHTGKECIKYLKEKRLPAQTFIPLQSIRVKPIFEKLRTLGGTAKLVF
DVIRFEPFLEKAVIYAVGNTLVCDNLEEAKDLSWSGERSKVVTVDGILLTKSGMMTGGIS
GGMEARSKQWDDKKVEGLKNSKERYESEMEELGSNREMQMKESEAQGKISGLEKKVQYSG
IEQKNIEKKLQTLRNEKKNIVEQIRANEPELQKLKSQTTKRRIEIKKLENRINEIVDEIY
KKFSESVGVKNIREYEENQLKGAEEMAEQRIGLSNQMSKLKYQLEYEEKRDMASPITELE
SYLDSLDRKLKELEKKDLEAKVVTEKARAEINKISKELKEWKSKLDECEKIIQELKKRSA
IFATGLGNISREIALKERQIEQLQSRKQEILERCELEQIRLPTNADPMETGSSTHDRSHR
QERRLADREKLELEFKQKMDTLISDIERTAPNLKALEQYETLQVKERAAIEEFERAREEE
KKIVDKYNSVKRTRYDLFMEAFNHISSVIDKIYKQLTKSNTHPLGGTAYLNLENEDDPFL
HGIKYTAMPPTKRFRDMEQLSGGEKTVAALALLFSIHSYRPSPFFILDEVDAALDNLNVA
KVAGFIRSKSCNSSRGAEESDGGSGFQSIVISLKDSFYDKAEALVGVYRDGEKSCSRTLT
FDLTKYRES
Download sequence
Identical sequences A0A2G5DPE8
Aquca_017_00733.1|PACid:22031351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]